Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4175958..4176577 Replicon chromosome
Accession NZ_CP107463
Organism Klebsiella pneumoniae strain CRKP_12

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH534_RS20740 Protein ID WP_002892050.1
Coordinates 4176359..4176577 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH534_RS20735 Protein ID WP_002892066.1
Coordinates 4175958..4176332 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH534_RS20725 4171110..4172303 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH534_RS20730 4172326..4175472 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH534_RS20735 4175958..4176332 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH534_RS20740 4176359..4176577 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH534_RS20745 4176736..4177302 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH534_RS20750 4177274..4177414 - 141 WP_004147370.1 hypothetical protein -
OH534_RS20755 4177435..4177905 + 471 WP_002892026.1 YlaC family protein -
OH534_RS20760 4177880..4179331 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH534_RS20765 4179432..4180130 + 699 WP_002892021.1 GNAT family protein -
OH534_RS20770 4180127..4180267 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH534_RS20775 4180267..4180530 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261415 WP_002892050.1 NZ_CP107463:4176359-4176577 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261415 WP_002892066.1 NZ_CP107463:4175958-4176332 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References