Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 91065..91708 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107460 | ||
Organism | Klebsiella pneumoniae strain CRKP_13 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH496_RS29000 | Protein ID | WP_001044770.1 |
Coordinates | 91065..91481 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH496_RS29005 | Protein ID | WP_001261282.1 |
Coordinates | 91478..91708 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH496_RS28980 (87168) | 87168..87440 | - | 273 | Protein_108 | transposase | - |
OH496_RS28990 (88422) | 88422..89444 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH496_RS28995 (89429) | 89429..90991 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH496_RS29000 (91065) | 91065..91481 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH496_RS29005 (91478) | 91478..91708 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH496_RS29010 (91665) | 91665..92126 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH496_RS29015 (92287) | 92287..93231 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH496_RS29020 (93268) | 93268..93660 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH496_RS29025 (93718) | 93718..94239 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH496_RS29030 (94285) | 94285..94488 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH496_RS29035 (94518) | 94518..95522 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH496_RS29040 (95706) | 95706..96485 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154719 | 154719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261404 WP_001044770.1 NZ_CP107460:c91481-91065 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |