Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 48886..49622 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107459 | ||
| Organism | Klebsiella pneumoniae strain CRKP_13 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | OH496_RS27590 | Protein ID | WP_003026803.1 |
| Coordinates | 48886..49368 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OH496_RS27595 | Protein ID | WP_003026799.1 |
| Coordinates | 49356..49622 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH496_RS27565 | 44048..44536 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| OH496_RS27570 | 44523..45485 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| OH496_RS27575 | 45662..46827 | + | 1166 | Protein_55 | IS3 family transposase | - |
| OH496_RS27580 | 47036..47167 | - | 132 | WP_004218042.1 | hypothetical protein | - |
| OH496_RS27585 | 47328..48674 | - | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| OH496_RS27590 | 48886..49368 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| OH496_RS27595 | 49356..49622 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OH496_RS27600 | 49798..50052 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| OH496_RS27605 | 50128..50385 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| OH496_RS27610 | 50434..50637 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| OH496_RS27615 | 50671..51039 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| OH496_RS27620 | 51083..51577 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| OH496_RS27625 | 51608..52183 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| OH496_RS27630 | 52171..52440 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| OH496_RS27635 | 52798..53148 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| OH496_RS27640 | 53198..53560 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205641 | 205641 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T261394 WP_003026803.1 NZ_CP107459:c49368-48886 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |