Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 61244..61887 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107454 | ||
Organism | Klebsiella pneumoniae strain CRKP_14 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH499_RS28455 | Protein ID | WP_001044770.1 |
Coordinates | 61244..61660 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH499_RS28460 | Protein ID | WP_001261282.1 |
Coordinates | 61657..61887 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH499_RS28435 (57347) | 57347..57619 | - | 273 | Protein_81 | transposase | - |
OH499_RS28445 (58601) | 58601..59623 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH499_RS28450 (59608) | 59608..61170 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH499_RS28455 (61244) | 61244..61660 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH499_RS28460 (61657) | 61657..61887 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH499_RS28465 (61844) | 61844..62305 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH499_RS28470 (62466) | 62466..63410 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH499_RS28475 (63447) | 63447..63839 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH499_RS28480 (63897) | 63897..64418 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH499_RS28485 (64464) | 64464..64667 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH499_RS28490 (64697) | 64697..65701 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH499_RS28495 (65885) | 65885..66664 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaKPC-2 / catA2 / blaCTX-M-65 | - | 1..96034 | 96034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261379 WP_001044770.1 NZ_CP107454:c61660-61244 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |