Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 33470..34206 Replicon plasmid unnamed1
Accession NZ_CP107453
Organism Klebsiella pneumoniae strain CRKP_14

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OH499_RS27265 Protein ID WP_003026803.1
Coordinates 33470..33952 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OH499_RS27270 Protein ID WP_003026799.1
Coordinates 33940..34206 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH499_RS27240 28545..29033 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
OH499_RS27245 29020..29982 + 963 WP_004152113.1 zinc metalloprotease HtpX -
OH499_RS27250 30159..31324 + 1166 Protein_34 IS3 family transposase -
OH499_RS27255 31472..31867 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
OH499_RS27260 31916..33262 - 1347 WP_077253535.1 ISNCY family transposase -
OH499_RS27265 33470..33952 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OH499_RS27270 33940..34206 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OH499_RS27275 34382..34636 - 255 WP_004152108.1 hypothetical protein -
OH499_RS27280 34712..34969 - 258 WP_004152107.1 hypothetical protein -
OH499_RS27285 35018..35221 - 204 WP_004152106.1 HHA domain-containing protein -
OH499_RS27290 35255..35623 - 369 WP_004152105.1 hypothetical protein -
OH499_RS27295 35667..36161 - 495 WP_004152104.1 DNA-binding protein -
OH499_RS27300 36192..36767 - 576 WP_004152103.1 hypothetical protein -
OH499_RS27305 36755..37024 - 270 WP_004152102.1 hypothetical protein -
OH499_RS27310 37382..37732 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OH499_RS27315 37782..38144 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / dfrA14 / blaCTX-M-15 / aac(3)-IIa - 1..175839 175839


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T261374 WP_003026803.1 NZ_CP107453:c33952-33470 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT261374 WP_003026799.1 NZ_CP107453:c34206-33940 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References