Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 33470..34206 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107453 | ||
| Organism | Klebsiella pneumoniae strain CRKP_14 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | OH499_RS27265 | Protein ID | WP_003026803.1 |
| Coordinates | 33470..33952 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OH499_RS27270 | Protein ID | WP_003026799.1 |
| Coordinates | 33940..34206 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH499_RS27240 | 28545..29033 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| OH499_RS27245 | 29020..29982 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| OH499_RS27250 | 30159..31324 | + | 1166 | Protein_34 | IS3 family transposase | - |
| OH499_RS27255 | 31472..31867 | - | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| OH499_RS27260 | 31916..33262 | - | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| OH499_RS27265 | 33470..33952 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| OH499_RS27270 | 33940..34206 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OH499_RS27275 | 34382..34636 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| OH499_RS27280 | 34712..34969 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| OH499_RS27285 | 35018..35221 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| OH499_RS27290 | 35255..35623 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| OH499_RS27295 | 35667..36161 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| OH499_RS27300 | 36192..36767 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| OH499_RS27305 | 36755..37024 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| OH499_RS27310 | 37382..37732 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| OH499_RS27315 | 37782..38144 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB1 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / dfrA14 / blaCTX-M-15 / aac(3)-IIa | - | 1..175839 | 175839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T261374 WP_003026803.1 NZ_CP107453:c33952-33470 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |