Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3626718..3627372 | Replicon | chromosome |
| Accession | NZ_CP107452 | ||
| Organism | Klebsiella pneumoniae strain CRKP_14 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R4YHX2 |
| Locus tag | OH499_RS17955 | Protein ID | WP_004144731.1 |
| Coordinates | 3626965..3627372 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | OH499_RS17950 | Protein ID | WP_002916312.1 |
| Coordinates | 3626718..3626984 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH499_RS17925 | 3621874..3623307 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| OH499_RS17930 | 3623426..3624154 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| OH499_RS17935 | 3624204..3624515 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| OH499_RS17940 | 3624679..3625338 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| OH499_RS17945 | 3625489..3626472 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| OH499_RS17950 | 3626718..3626984 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| OH499_RS17955 | 3626965..3627372 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
| OH499_RS17960 | 3627379..3627900 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| OH499_RS17965 | 3628001..3628897 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| OH499_RS17970 | 3628920..3629633 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OH499_RS17975 | 3629639..3631372 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T261369 WP_004144731.1 NZ_CP107452:3626965-3627372 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378E4P6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |