Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 125415..126058 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107448 | ||
| Organism | Klebsiella pneumoniae strain CRKP_15 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OH505_RS27655 | Protein ID | WP_014386165.1 |
| Coordinates | 125415..125831 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | OH505_RS27660 | Protein ID | WP_032408893.1 |
| Coordinates | 125828..126058 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH505_RS27630 | 122035..122466 | + | 432 | WP_014386161.1 | conjugation system SOS inhibitor PsiB | - |
| OH505_RS27635 | 122463..123191 | + | 729 | WP_014386162.1 | plasmid SOS inhibition protein A | - |
| OH505_RS27640 | 123188..123514 | + | 327 | WP_001568059.1 | hypothetical protein | - |
| OH505_RS27645 | 123570..123944 | + | 375 | WP_032408891.1 | hypothetical protein | - |
| OH505_RS27650 | 124124..125092 | - | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
| OH505_RS27655 | 125415..125831 | - | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| OH505_RS27660 | 125828..126058 | - | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH505_RS27665 | 126378..126812 | + | 435 | WP_000103648.1 | RidA family protein | - |
| OH505_RS27670 | 126817..127491 | + | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| OH505_RS27675 | 127507..128664 | + | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| OH505_RS27680 | 128835..129983 | + | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| OH505_RS27685 | 130002..130985 | + | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205652 | 205652 | |
| - | flank | IS/Tn | - | - | 124124..125092 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T261348 WP_014386165.1 NZ_CP107448:c125831-125415 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|