Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4801631..4802441 | Replicon | chromosome |
Accession | NZ_CP107447 | ||
Organism | Klebsiella pneumoniae strain CRKP_15 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0H3GMP0 |
Locus tag | OH505_RS23805 | Protein ID | WP_002887280.1 |
Coordinates | 4801631..4802164 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | OH505_RS23810 | Protein ID | WP_002887278.1 |
Coordinates | 4802175..4802441 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH505_RS23800 | 4800462..4801583 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
OH505_RS23805 | 4801631..4802164 | - | 534 | WP_002887280.1 | type II toxin-antitoxin system toxin KacT | Toxin |
OH505_RS23810 | 4802175..4802441 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
OH505_RS23815 | 4802544..4803977 | - | 1434 | WP_002887275.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
OH505_RS23820 | 4803967..4804650 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
OH505_RS23825 | 4804822..4806207 | + | 1386 | WP_002887267.1 | efflux transporter outer membrane subunit | - |
OH505_RS23830 | 4806225..4806569 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19838.70 Da Isoelectric Point: 5.2614
>T261343 WP_002887280.1 NZ_CP107447:c4802164-4801631 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
PDB | 5XUN |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |