Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 91071..91714 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107443 | ||
Organism | Klebsiella pneumoniae strain CRKP_16 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH519_RS28665 | Protein ID | WP_001044770.1 |
Coordinates | 91071..91487 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH519_RS28670 | Protein ID | WP_001261282.1 |
Coordinates | 91484..91714 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH519_RS28645 (87174) | 87174..87446 | - | 273 | Protein_108 | transposase | - |
OH519_RS28655 (88428) | 88428..89450 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH519_RS28660 (89435) | 89435..90997 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH519_RS28665 (91071) | 91071..91487 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH519_RS28670 (91484) | 91484..91714 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH519_RS28675 (91671) | 91671..92132 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH519_RS28680 (92293) | 92293..93237 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH519_RS28685 (93274) | 93274..93666 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH519_RS28690 (93724) | 93724..94245 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH519_RS28695 (94291) | 94291..94494 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH519_RS28700 (94524) | 94524..95528 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH519_RS28705 (95712) | 95712..96491 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154725 | 154725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261331 WP_001044770.1 NZ_CP107443:c91487-91071 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |