Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 149202..149947 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107437 | ||
Organism | Klebsiella pneumoniae strain CRKP_17 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A331KSM6 |
Locus tag | OH508_RS27800 | Protein ID | WP_032408901.1 |
Coordinates | 149202..149693 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | OH508_RS27805 | Protein ID | WP_014386183.1 |
Coordinates | 149681..149947 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH508_RS27775 | 144886..145641 | + | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OH508_RS27780 | 145903..146343 | + | 441 | WP_014386179.1 | transposase | - |
OH508_RS27785 | 146340..146690 | + | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OH508_RS27790 | 146721..148313 | + | 1593 | Protein_162 | IS66 family transposase | - |
OH508_RS27795 | 148510..148761 | + | 252 | WP_032408900.1 | aldo/keto reductase | - |
OH508_RS27800 | 149202..149693 | - | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
OH508_RS27805 | 149681..149947 | - | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
OH508_RS27810 | 150183..150302 | + | 120 | WP_223156217.1 | type I toxin-antitoxin system Hok family toxin | - |
OH508_RS27815 | 150546..151031 | - | 486 | WP_014386185.1 | hypothetical protein | - |
OH508_RS27820 | 151221..151493 | + | 273 | WP_032408902.1 | hypothetical protein | - |
OH508_RS27825 | 151490..151840 | + | 351 | WP_014386186.1 | hypothetical protein | - |
OH508_RS27830 | 152477..152803 | + | 327 | WP_014386187.1 | hypothetical protein | - |
OH508_RS27835 | 152865..153077 | + | 213 | WP_014386188.1 | hypothetical protein | - |
OH508_RS27840 | 153088..153312 | + | 225 | WP_014386189.1 | hypothetical protein | - |
OH508_RS27845 | 153393..153713 | + | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OH508_RS27850 | 153703..153981 | + | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
OH508_RS27855 | 153982..154395 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205638 | 205638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T261297 WP_032408901.1 NZ_CP107437:c149693-149202 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|