Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 48883..49619 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107437 | ||
| Organism | Klebsiella pneumoniae strain CRKP_17 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | OH508_RS27270 | Protein ID | WP_003026803.1 |
| Coordinates | 48883..49365 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OH508_RS27275 | Protein ID | WP_003026799.1 |
| Coordinates | 49353..49619 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH508_RS27245 | 44045..44533 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| OH508_RS27250 | 44520..45482 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| OH508_RS27255 | 45659..46824 | + | 1166 | Protein_55 | IS3 family transposase | - |
| OH508_RS27260 | 47033..47164 | - | 132 | WP_004218042.1 | hypothetical protein | - |
| OH508_RS27265 | 47325..48671 | - | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| OH508_RS27270 | 48883..49365 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| OH508_RS27275 | 49353..49619 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OH508_RS27280 | 49795..50049 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| OH508_RS27285 | 50125..50382 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| OH508_RS27290 | 50431..50634 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| OH508_RS27295 | 50668..51036 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| OH508_RS27300 | 51080..51574 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| OH508_RS27305 | 51605..52180 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| OH508_RS27310 | 52168..52437 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| OH508_RS27315 | 52795..53145 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| OH508_RS27320 | 53195..53557 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205638 | 205638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T261295 WP_003026803.1 NZ_CP107437:c49365-48883 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |