Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4193766..4194385 Replicon chromosome
Accession NZ_CP107436
Organism Klebsiella pneumoniae strain CRKP_17

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH508_RS20870 Protein ID WP_002892050.1
Coordinates 4194167..4194385 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH508_RS20865 Protein ID WP_002892066.1
Coordinates 4193766..4194140 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH508_RS20855 4188918..4190111 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH508_RS20860 4190134..4193280 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH508_RS20865 4193766..4194140 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH508_RS20870 4194167..4194385 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH508_RS20875 4194544..4195110 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH508_RS20880 4195082..4195222 - 141 WP_004147370.1 hypothetical protein -
OH508_RS20885 4195243..4195713 + 471 WP_002892026.1 YlaC family protein -
OH508_RS20890 4195688..4197139 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH508_RS20895 4197240..4197938 + 699 WP_002892021.1 GNAT family protein -
OH508_RS20900 4197935..4198075 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH508_RS20905 4198075..4198338 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261290 WP_002892050.1 NZ_CP107436:4194167-4194385 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261290 WP_002892066.1 NZ_CP107436:4193766-4194140 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References