Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 90193..90715 Replicon plasmid unnamed2
Accession NZ_CP107434
Organism Klebsiella pneumoniae strain CRKP_18

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag OH509_RS28665 Protein ID WP_000220561.1
Coordinates 90434..90715 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag OH509_RS28660 Protein ID WP_000121743.1
Coordinates 90193..90444 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH509_RS28640 (86338) 86338..86691 - 354 WP_024129958.1 DNA distortion polypeptide 3 -
OH509_RS28645 (86828) 86828..87274 - 447 WP_001074384.1 hypothetical protein -
OH509_RS28650 (87278) 87278..88120 - 843 WP_000435064.1 replication initiation protein -
OH509_RS28655 (88141) 88141..88980 - 840 WP_024129959.1 replication initiation protein -
OH509_RS28660 (90193) 90193..90444 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
OH509_RS28665 (90434) 90434..90715 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OH509_RS28670 (90954) 90954..91046 - 93 Protein_113 IS6 family transposase -
OH509_RS28675 (91212) 91212..92411 - 1200 Protein_114 IS91 family transposase -
OH509_RS28680 (92421) 92421..92609 - 189 WP_000957857.1 hypothetical protein -
OH509_RS28685 (92839) 92839..92943 + 105 WP_032409716.1 hypothetical protein -
OH509_RS28690 (93072) 93072..93329 + 258 WP_000764642.1 hypothetical protein -
OH509_RS28695 (93387) 93387..94163 - 777 WP_000015958.1 site-specific integrase -
OH509_RS28700 (94160) 94160..94903 - 744 WP_000129823.1 hypothetical protein -
OH509_RS28705 (94954) 94954..95304 - 351 WP_000493378.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-IIa / rmtB / blaTEM-1B - 1..118453 118453


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T261279 WP_000220561.1 NZ_CP107434:90434-90715 [Klebsiella pneumoniae]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT261279 WP_000121743.1 NZ_CP107434:90193-90444 [Klebsiella pneumoniae]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References