Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 148847..149490 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107433 | ||
| Organism | Klebsiella pneumoniae strain CRKP_18 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH509_RS27970 | Protein ID | WP_001044770.1 |
| Coordinates | 148847..149263 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH509_RS27975 | Protein ID | WP_001261282.1 |
| Coordinates | 149260..149490 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH509_RS27950 (144950) | 144950..145222 | - | 273 | Protein_190 | transposase | - |
| OH509_RS27960 (146204) | 146204..147226 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH509_RS27965 (147211) | 147211..148773 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH509_RS27970 (148847) | 148847..149263 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH509_RS27975 (149260) | 149260..149490 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH509_RS27980 (149447) | 149447..149908 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| OH509_RS27985 (150069) | 150069..151013 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| OH509_RS27990 (151050) | 151050..151442 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| OH509_RS27995 (151500) | 151500..152021 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| OH509_RS28000 (152067) | 152067..152270 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| OH509_RS28005 (152300) | 152300..153304 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH509_RS28010 (153488) | 153488..154267 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / blaKPC-2 / dfrA14 | - | 1..169677 | 169677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261272 WP_001044770.1 NZ_CP107433:c149263-148847 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |