Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 35253..35998 Replicon plasmid unnamed1
Accession NZ_CP107433
Organism Klebsiella pneumoniae strain CRKP_18

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag OH509_RS27205 Protein ID WP_032408901.1
Coordinates 35253..35744 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag OH509_RS27210 Protein ID WP_014386183.1
Coordinates 35732..35998 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH509_RS27180 (30937) 30937..31692 + 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -
OH509_RS27185 (31954) 31954..32394 + 441 WP_014386179.1 transposase -
OH509_RS27190 (32391) 32391..32741 + 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
OH509_RS27195 (32772) 32772..34364 + 1593 Protein_39 IS66 family transposase -
OH509_RS27200 (34561) 34561..34812 + 252 WP_032408900.1 aldo/keto reductase -
OH509_RS27205 (35253) 35253..35744 - 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
OH509_RS27210 (35732) 35732..35998 - 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
OH509_RS27215 (36234) 36234..36353 + 120 WP_223156217.1 type I toxin-antitoxin system Hok family toxin -
OH509_RS27220 (36597) 36597..37082 - 486 WP_014386185.1 hypothetical protein -
OH509_RS27225 (37272) 37272..37544 + 273 WP_032408902.1 hypothetical protein -
OH509_RS27230 (37541) 37541..37891 + 351 WP_014386186.1 hypothetical protein -
OH509_RS27235 (38528) 38528..38854 + 327 WP_014386187.1 hypothetical protein -
OH509_RS27240 (38916) 38916..39128 + 213 WP_014386188.1 hypothetical protein -
OH509_RS27245 (39139) 39139..39363 + 225 WP_014386189.1 hypothetical protein -
OH509_RS27250 (39444) 39444..39764 + 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
OH509_RS27255 (39754) 39754..40032 + 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
OH509_RS27260 (40033) 40033..40446 + 414 WP_013023817.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / blaKPC-2 / dfrA14 - 1..169677 169677


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T261267 WP_032408901.1 NZ_CP107433:c35744-35253 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT261267 WP_014386183.1 NZ_CP107433:c35998-35732 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References