Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11459..12102 Replicon plasmid unnamed1
Accession NZ_CP107433
Organism Klebsiella pneumoniae strain CRKP_18

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OH509_RS27075 Protein ID WP_014386165.1
Coordinates 11459..11875 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag OH509_RS27080 Protein ID WP_032408893.1
Coordinates 11872..12102 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH509_RS27050 (8079) 8079..8510 + 432 WP_001568057.1 conjugation system SOS inhibitor PsiB -
OH509_RS27055 (8507) 8507..9235 + 729 WP_001568058.1 plasmid SOS inhibition protein A -
OH509_RS27060 (9232) 9232..9558 + 327 WP_182000399.1 theronine dehydrogenase -
OH509_RS27065 (9614) 9614..9988 + 375 WP_032408891.1 hypothetical protein -
OH509_RS27070 (10168) 10168..11136 - 969 WP_074422984.1 IS5-like element IS903B family transposase -
OH509_RS27075 (11459) 11459..11875 - 417 WP_014386165.1 PIN domain-containing protein Toxin
OH509_RS27080 (11872) 11872..12102 - 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH509_RS27085 (12422) 12422..12856 + 435 WP_000103648.1 RidA family protein -
OH509_RS27090 (12861) 12861..13535 + 675 WP_014386166.1 DUF1028 domain-containing protein -
OH509_RS27095 (13551) 13551..14708 + 1158 WP_032408895.1 acetylornithine deacetylase -
OH509_RS27100 (14879) 14879..16027 + 1149 WP_014386168.1 ABC transporter ATP-binding protein -
OH509_RS27105 (16046) 16046..17029 + 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / blaKPC-2 / dfrA14 - 1..169677 169677
- flank IS/Tn - - 10168..11136 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T261266 WP_014386165.1 NZ_CP107433:c11875-11459 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT261266 WP_032408893.1 NZ_CP107433:c12102-11872 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References