Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11459..12102 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107433 | ||
| Organism | Klebsiella pneumoniae strain CRKP_18 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OH509_RS27075 | Protein ID | WP_014386165.1 |
| Coordinates | 11459..11875 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | OH509_RS27080 | Protein ID | WP_032408893.1 |
| Coordinates | 11872..12102 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH509_RS27050 (8079) | 8079..8510 | + | 432 | WP_001568057.1 | conjugation system SOS inhibitor PsiB | - |
| OH509_RS27055 (8507) | 8507..9235 | + | 729 | WP_001568058.1 | plasmid SOS inhibition protein A | - |
| OH509_RS27060 (9232) | 9232..9558 | + | 327 | WP_182000399.1 | theronine dehydrogenase | - |
| OH509_RS27065 (9614) | 9614..9988 | + | 375 | WP_032408891.1 | hypothetical protein | - |
| OH509_RS27070 (10168) | 10168..11136 | - | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
| OH509_RS27075 (11459) | 11459..11875 | - | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| OH509_RS27080 (11872) | 11872..12102 | - | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH509_RS27085 (12422) | 12422..12856 | + | 435 | WP_000103648.1 | RidA family protein | - |
| OH509_RS27090 (12861) | 12861..13535 | + | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| OH509_RS27095 (13551) | 13551..14708 | + | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| OH509_RS27100 (14879) | 14879..16027 | + | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| OH509_RS27105 (16046) | 16046..17029 | + | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / blaKPC-2 / dfrA14 | - | 1..169677 | 169677 | |
| - | flank | IS/Tn | - | - | 10168..11136 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T261266 WP_014386165.1 NZ_CP107433:c11875-11459 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|