Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4200440..4201059 Replicon chromosome
Accession NZ_CP107432
Organism Klebsiella pneumoniae strain CRKP_18

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH509_RS20905 Protein ID WP_002892050.1
Coordinates 4200841..4201059 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH509_RS20900 Protein ID WP_002892066.1
Coordinates 4200440..4200814 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH509_RS20890 4195592..4196785 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH509_RS20895 4196808..4199954 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH509_RS20900 4200440..4200814 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH509_RS20905 4200841..4201059 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH509_RS20910 4201218..4201784 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH509_RS20915 4201756..4201896 - 141 WP_004147370.1 hypothetical protein -
OH509_RS20920 4201917..4202387 + 471 WP_002892026.1 YlaC family protein -
OH509_RS20925 4202362..4203813 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH509_RS20930 4203914..4204612 + 699 WP_002892021.1 GNAT family protein -
OH509_RS20935 4204609..4204749 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH509_RS20940 4204749..4205012 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261261 WP_002892050.1 NZ_CP107432:4200841-4201059 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261261 WP_002892066.1 NZ_CP107432:4200440-4200814 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References