Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 742547..743322 | Replicon | chromosome |
Accession | NZ_CP107432 | ||
Organism | Klebsiella pneumoniae strain CRKP_18 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | OH509_RS03710 | Protein ID | WP_004150910.1 |
Coordinates | 742837..743322 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | OH509_RS03705 | Protein ID | WP_004150912.1 |
Coordinates | 742547..742840 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH509_RS03685 | 737755..738357 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
OH509_RS03690 | 738455..739366 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
OH509_RS03695 | 739367..740515 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
OH509_RS03700 | 740526..741902 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
OH509_RS03705 | 742547..742840 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
OH509_RS03710 | 742837..743322 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
OH509_RS03715 | 744026..744535 | + | 510 | Protein_730 | hypothetical protein | - |
OH509_RS03720 | 744600..745580 | + | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
OH509_RS03725 | 745730..745819 | + | 90 | Protein_732 | hypothetical protein | - |
OH509_RS03730 | 745916..746132 | + | 217 | Protein_733 | transposase | - |
OH509_RS03735 | 746738..747610 | + | 873 | WP_004188557.1 | ParA family protein | - |
OH509_RS03740 | 747610..747993 | + | 384 | WP_004150906.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T261254 WP_004150910.1 NZ_CP107432:742837-743322 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |