Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 48886..49622 Replicon plasmid unnamed1
Accession NZ_CP107427
Organism Klebsiella pneumoniae strain CRKP_19

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OH521_RS27195 Protein ID WP_003026803.1
Coordinates 48886..49368 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OH521_RS27200 Protein ID WP_003026799.1
Coordinates 49356..49622 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH521_RS27170 44048..44536 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
OH521_RS27175 44523..45485 + 963 WP_004152113.1 zinc metalloprotease HtpX -
OH521_RS27180 45662..46827 + 1166 Protein_55 IS3 family transposase -
OH521_RS27185 47036..47167 - 132 WP_004218042.1 hypothetical protein -
OH521_RS27190 47328..48674 - 1347 WP_020314316.1 ISNCY family transposase -
OH521_RS27195 48886..49368 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OH521_RS27200 49356..49622 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OH521_RS27205 49798..50052 - 255 WP_004152108.1 hypothetical protein -
OH521_RS27210 50128..50385 - 258 WP_004152107.1 hypothetical protein -
OH521_RS27215 50434..50637 - 204 WP_004152106.1 HHA domain-containing protein -
OH521_RS27220 50671..51039 - 369 WP_004152105.1 hypothetical protein -
OH521_RS27225 51083..51577 - 495 WP_004152104.1 DNA-binding protein -
OH521_RS27230 51608..52183 - 576 WP_004152103.1 hypothetical protein -
OH521_RS27235 52171..52440 - 270 WP_004152102.1 hypothetical protein -
OH521_RS27240 52798..53148 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OH521_RS27245 53198..53560 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia - 1..205639 205639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T261239 WP_003026803.1 NZ_CP107427:c49368-48886 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT261239 WP_003026799.1 NZ_CP107427:c49622-49356 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References