Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4002939..4003558 Replicon chromosome
Accession NZ_CP107426
Organism Klebsiella pneumoniae strain CRKP_19

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH521_RS19610 Protein ID WP_002892050.1
Coordinates 4002939..4003157 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH521_RS19615 Protein ID WP_002892066.1
Coordinates 4003184..4003558 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH521_RS19575 3998986..3999249 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
OH521_RS19580 3999249..3999389 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH521_RS19585 3999386..4000084 - 699 WP_002892021.1 GNAT family protein -
OH521_RS19590 4000185..4001636 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH521_RS19595 4001611..4002081 - 471 WP_002892026.1 YlaC family protein -
OH521_RS19600 4002102..4002242 + 141 WP_004147370.1 hypothetical protein -
OH521_RS19605 4002214..4002780 - 567 WP_002892030.1 maltose O-acetyltransferase -
OH521_RS19610 4002939..4003157 - 219 WP_002892050.1 HHA domain-containing protein Toxin
OH521_RS19615 4003184..4003558 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH521_RS19620 4004044..4007190 - 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH521_RS19625 4007213..4008406 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261237 WP_002892050.1 NZ_CP107426:c4003157-4002939 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261237 WP_002892066.1 NZ_CP107426:c4003558-4003184 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References