Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 68886..69529 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107423 | ||
Organism | Klebsiella pneumoniae strain CRKP_20 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH530_RS27250 | Protein ID | WP_001044770.1 |
Coordinates | 69113..69529 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH530_RS27245 | Protein ID | WP_001261282.1 |
Coordinates | 68886..69116 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH530_RS27210 (64109) | 64109..64888 | - | 780 | WP_013214009.1 | site-specific integrase | - |
OH530_RS27215 (65072) | 65072..66076 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
OH530_RS27220 (66106) | 66106..66309 | - | 204 | WP_011977813.1 | hypothetical protein | - |
OH530_RS27225 (66355) | 66355..66876 | - | 522 | WP_013214008.1 | hypothetical protein | - |
OH530_RS27230 (66934) | 66934..67326 | - | 393 | WP_011977811.1 | hypothetical protein | - |
OH530_RS27235 (67363) | 67363..68307 | - | 945 | WP_011977810.1 | hypothetical protein | - |
OH530_RS27240 (68468) | 68468..68929 | - | 462 | WP_014343465.1 | hypothetical protein | - |
OH530_RS27245 (68886) | 68886..69116 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH530_RS27250 (69113) | 69113..69529 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH530_RS27255 (69603) | 69603..71165 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH530_RS27260 (71150) | 71150..72172 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
OH530_RS27265 (72428) | 72428..73125 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
OH530_RS27270 (73154) | 73154..73426 | + | 273 | Protein_98 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..159410 | 159410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261218 WP_001044770.1 NZ_CP107423:69113-69529 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |