Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 68886..69529 Replicon plasmid unnamed1
Accession NZ_CP107423
Organism Klebsiella pneumoniae strain CRKP_20

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH530_RS27250 Protein ID WP_001044770.1
Coordinates 69113..69529 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH530_RS27245 Protein ID WP_001261282.1
Coordinates 68886..69116 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH530_RS27210 (64109) 64109..64888 - 780 WP_013214009.1 site-specific integrase -
OH530_RS27215 (65072) 65072..66076 - 1005 WP_011977814.1 hypothetical protein -
OH530_RS27220 (66106) 66106..66309 - 204 WP_011977813.1 hypothetical protein -
OH530_RS27225 (66355) 66355..66876 - 522 WP_013214008.1 hypothetical protein -
OH530_RS27230 (66934) 66934..67326 - 393 WP_011977811.1 hypothetical protein -
OH530_RS27235 (67363) 67363..68307 - 945 WP_011977810.1 hypothetical protein -
OH530_RS27240 (68468) 68468..68929 - 462 WP_014343465.1 hypothetical protein -
OH530_RS27245 (68886) 68886..69116 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH530_RS27250 (69113) 69113..69529 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH530_RS27255 (69603) 69603..71165 + 1563 WP_004206609.1 AAA family ATPase -
OH530_RS27260 (71150) 71150..72172 + 1023 WP_000361404.1 helicase UvrD -
OH530_RS27265 (72428) 72428..73125 + 698 WP_223174630.1 IS1 family transposase -
OH530_RS27270 (73154) 73154..73426 + 273 Protein_98 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..159410 159410


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T261218 WP_001044770.1 NZ_CP107423:69113-69529 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT261218 WP_001261282.1 NZ_CP107423:68886-69116 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References