Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 67487..68130 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107418 | ||
| Organism | Klebsiella pneumoniae strain CRKP_21 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH498_RS27440 | Protein ID | WP_001044770.1 |
| Coordinates | 67714..68130 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH498_RS27435 | Protein ID | WP_001261282.1 |
| Coordinates | 67487..67717 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH498_RS27400 (62710) | 62710..63489 | - | 780 | WP_013214009.1 | site-specific integrase | - |
| OH498_RS27405 (63673) | 63673..64677 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH498_RS27410 (64707) | 64707..64910 | - | 204 | WP_011977813.1 | hypothetical protein | - |
| OH498_RS27415 (64956) | 64956..65477 | - | 522 | WP_013214008.1 | hypothetical protein | - |
| OH498_RS27420 (65535) | 65535..65927 | - | 393 | WP_011977811.1 | hypothetical protein | - |
| OH498_RS27425 (65964) | 65964..66908 | - | 945 | WP_011977810.1 | hypothetical protein | - |
| OH498_RS27430 (67069) | 67069..67530 | - | 462 | WP_014343465.1 | hypothetical protein | - |
| OH498_RS27435 (67487) | 67487..67717 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH498_RS27440 (67714) | 67714..68130 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH498_RS27445 (68204) | 68204..69766 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH498_RS27450 (69751) | 69751..70773 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH498_RS27455 (71029) | 71029..71726 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| OH498_RS27460 (71755) | 71755..72027 | + | 273 | Protein_101 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..210034 | 210034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261193 WP_001044770.1 NZ_CP107418:67714-68130 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |