Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 60325..60968 Replicon plasmid unnamed2
Accession NZ_CP107414
Organism Klebsiella pneumoniae strain CRKP_22

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH525_RS28175 Protein ID WP_001044770.1
Coordinates 60552..60968 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH525_RS28170 Protein ID WP_001261282.1
Coordinates 60325..60555 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH525_RS28135 (55548) 55548..56327 - 780 WP_013214009.1 site-specific integrase -
OH525_RS28140 (56511) 56511..57515 - 1005 WP_011977814.1 hypothetical protein -
OH525_RS28145 (57545) 57545..57748 - 204 WP_011977813.1 hypothetical protein -
OH525_RS28150 (57794) 57794..58315 - 522 WP_013214008.1 hypothetical protein -
OH525_RS28155 (58373) 58373..58765 - 393 WP_011977811.1 hypothetical protein -
OH525_RS28160 (58802) 58802..59746 - 945 WP_011977810.1 hypothetical protein -
OH525_RS28165 (59907) 59907..60368 - 462 WP_014343465.1 hypothetical protein -
OH525_RS28170 (60325) 60325..60555 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH525_RS28175 (60552) 60552..60968 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH525_RS28180 (61042) 61042..62604 + 1563 WP_004206609.1 AAA family ATPase -
OH525_RS28185 (62589) 62589..63611 + 1023 WP_000361404.1 helicase UvrD -
OH525_RS28190 (63867) 63867..64564 + 698 WP_223174630.1 IS1 family transposase -
OH525_RS28195 (64593) 64593..64865 + 273 Protein_82 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..146158 146158


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T261171 WP_001044770.1 NZ_CP107414:60552-60968 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT261171 WP_001261282.1 NZ_CP107414:60325-60555 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References