Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 149206..149951 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107413 | ||
| Organism | Klebsiella pneumoniae strain CRKP_22 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | OH525_RS27465 | Protein ID | WP_032408901.1 |
| Coordinates | 149206..149697 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | OH525_RS27470 | Protein ID | WP_014386183.1 |
| Coordinates | 149685..149951 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH525_RS27440 | 144890..145645 | + | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OH525_RS27445 | 145907..146347 | + | 441 | WP_014386179.1 | transposase | - |
| OH525_RS27450 | 146344..146694 | + | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OH525_RS27455 | 146725..148317 | + | 1593 | Protein_162 | IS66 family transposase | - |
| OH525_RS27460 | 148514..148765 | + | 252 | WP_032408900.1 | aldo/keto reductase | - |
| OH525_RS27465 | 149206..149697 | - | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| OH525_RS27470 | 149685..149951 | - | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| OH525_RS27475 | 150187..150306 | + | 120 | WP_223156217.1 | type I toxin-antitoxin system Hok family toxin | - |
| OH525_RS27480 | 150550..151035 | - | 486 | WP_014386185.1 | hypothetical protein | - |
| OH525_RS27485 | 151225..151497 | + | 273 | WP_032408902.1 | hypothetical protein | - |
| OH525_RS27490 | 151494..151844 | + | 351 | WP_014386186.1 | hypothetical protein | - |
| OH525_RS27495 | 152481..152807 | + | 327 | WP_014386187.1 | hypothetical protein | - |
| OH525_RS27500 | 152869..153081 | + | 213 | WP_014386188.1 | hypothetical protein | - |
| OH525_RS27505 | 153092..153316 | + | 225 | WP_014386189.1 | hypothetical protein | - |
| OH525_RS27510 | 153397..153717 | + | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OH525_RS27515 | 153707..153985 | + | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| OH525_RS27520 | 153986..154399 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205642 | 205642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T261170 WP_032408901.1 NZ_CP107413:c149697-149206 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|