Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 5690..6270 | Replicon | plasmid unnamed3 |
Accession | NZ_CP107401 | ||
Organism | Klebsiella pneumoniae strain CRKP_26 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OH520_RS28535 | Protein ID | WP_071177730.1 |
Coordinates | 5690..6004 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OH520_RS28540 | Protein ID | WP_000093040.1 |
Coordinates | 5992..6270 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH520_RS28510 | 1634..3598 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
OH520_RS28515 | 3598..4329 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OH520_RS28520 | 4336..4866 | + | 531 | WP_071177729.1 | hypothetical protein | - |
OH520_RS28525 | 4893..5072 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OH520_RS28530 | 5098..5526 | - | 429 | WP_001140599.1 | hypothetical protein | - |
OH520_RS28535 | 5690..6004 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH520_RS28540 | 5992..6270 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OH520_RS28545 | 6445..6810 | - | 366 | WP_072354022.1 | TonB family protein | - |
OH520_RS28550 | 6807..7178 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OH520_RS28555 | 7452..7697 | - | 246 | WP_032440458.1 | hypothetical protein | - |
OH520_RS28560 | 8024..9709 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
OH520_RS28565 | 9719..9976 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T261108 WP_071177730.1 NZ_CP107401:c6004-5690 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|