Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 149206..149951 Replicon plasmid unnamed1
Accession NZ_CP107399
Organism Klebsiella pneumoniae strain CRKP_26

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag OH520_RS27245 Protein ID WP_032408901.1
Coordinates 149206..149697 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag OH520_RS27250 Protein ID WP_014386183.1
Coordinates 149685..149951 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH520_RS27220 144890..145645 + 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -
OH520_RS27225 145907..146347 + 441 WP_014386179.1 transposase -
OH520_RS27230 146344..146694 + 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
OH520_RS27235 146725..148317 + 1593 Protein_162 IS66 family transposase -
OH520_RS27240 148514..148765 + 252 WP_032408900.1 aldo/keto reductase -
OH520_RS27245 149206..149697 - 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
OH520_RS27250 149685..149951 - 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
OH520_RS27255 150187..150306 + 120 WP_223156217.1 type I toxin-antitoxin system Hok family toxin -
OH520_RS27260 150550..151035 - 486 WP_014386185.1 hypothetical protein -
OH520_RS27265 151225..151497 + 273 WP_032408902.1 hypothetical protein -
OH520_RS27270 151494..151844 + 351 WP_014386186.1 hypothetical protein -
OH520_RS27275 152481..152807 + 327 WP_014386187.1 hypothetical protein -
OH520_RS27280 152869..153081 + 213 WP_014386188.1 hypothetical protein -
OH520_RS27285 153092..153316 + 225 WP_014386189.1 hypothetical protein -
OH520_RS27290 153397..153717 + 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
OH520_RS27295 153707..153985 + 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
OH520_RS27300 153986..154399 + 414 WP_013023817.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia - 1..205642 205642


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T261100 WP_032408901.1 NZ_CP107399:c149697-149206 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT261100 WP_014386183.1 NZ_CP107399:c149951-149685 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References