Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 838292..838946 | Replicon | chromosome |
| Accession | NZ_CP107398 | ||
| Organism | Klebsiella pneumoniae strain CRKP_26 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R4YHX2 |
| Locus tag | OH520_RS04220 | Protein ID | WP_004144731.1 |
| Coordinates | 838539..838946 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | OH520_RS04215 | Protein ID | WP_002916312.1 |
| Coordinates | 838292..838558 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH520_RS04190 | 833448..834881 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| OH520_RS04195 | 835000..835728 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| OH520_RS04200 | 835778..836089 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| OH520_RS04205 | 836253..836912 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| OH520_RS04210 | 837063..838046 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| OH520_RS04215 | 838292..838558 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| OH520_RS04220 | 838539..838946 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
| OH520_RS04225 | 838953..839474 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| OH520_RS04230 | 839575..840471 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| OH520_RS04235 | 840494..841207 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OH520_RS04240 | 841213..842946 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T261087 WP_004144731.1 NZ_CP107398:838539-838946 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378E4P6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |