Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3284042..3284558 | Replicon | chromosome |
Accession | NZ_CP107394 | ||
Organism | Klebsiella pneumoniae strain CRKP_27 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | OH529_RS16160 | Protein ID | WP_002886902.1 |
Coordinates | 3284274..3284558 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OH529_RS16155 | Protein ID | WP_002886901.1 |
Coordinates | 3284042..3284284 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH529_RS16140 | 3280071..3280811 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
OH529_RS16145 | 3280877..3282031 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
OH529_RS16150 | 3282054..3283964 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OH529_RS16155 | 3284042..3284284 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OH529_RS16160 | 3284274..3284558 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH529_RS16165 | 3284562..3285026 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OH529_RS16170 | 3285267..3287405 | - | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OH529_RS16175 | 3287762..3288505 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OH529_RS16180 | 3288508..3288681 | - | 174 | WP_002886906.1 | hypothetical protein | - |
OH529_RS16185 | 3288766..3289074 | + | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T261071 WP_002886902.1 NZ_CP107394:3284274-3284558 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |