Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 91838..92481 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107391 | ||
Organism | Klebsiella pneumoniae strain CRKP_28 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH501_RS27445 | Protein ID | WP_001044770.1 |
Coordinates | 91838..92254 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH501_RS27450 | Protein ID | WP_001261282.1 |
Coordinates | 92251..92481 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH501_RS27425 (87941) | 87941..88213 | - | 273 | Protein_110 | transposase | - |
OH501_RS27435 (89195) | 89195..90217 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH501_RS27440 (90202) | 90202..91764 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH501_RS27445 (91838) | 91838..92254 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH501_RS27450 (92251) | 92251..92481 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH501_RS27455 (92438) | 92438..92899 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH501_RS27460 (93060) | 93060..94004 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH501_RS27465 (94041) | 94041..94433 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH501_RS27470 (94491) | 94491..95012 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH501_RS27475 (95058) | 95058..95261 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH501_RS27480 (95291) | 95291..96295 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH501_RS27485 (96479) | 96479..97258 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155492 | 155492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261059 WP_001044770.1 NZ_CP107391:c92254-91838 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |