Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3332757..3333273 | Replicon | chromosome |
Accession | NZ_CP107390 | ||
Organism | Klebsiella pneumoniae strain CRKP_28 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | OH501_RS16425 | Protein ID | WP_002886902.1 |
Coordinates | 3332989..3333273 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OH501_RS16420 | Protein ID | WP_002886901.1 |
Coordinates | 3332757..3332999 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH501_RS16405 | 3328786..3329526 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
OH501_RS16410 | 3329592..3330746 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
OH501_RS16415 | 3330769..3332679 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OH501_RS16420 | 3332757..3332999 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OH501_RS16425 | 3332989..3333273 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH501_RS16430 | 3333277..3333741 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OH501_RS16435 | 3333982..3336120 | - | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OH501_RS16440 | 3336477..3337220 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OH501_RS16445 | 3337223..3337396 | - | 174 | WP_002886906.1 | hypothetical protein | - |
OH501_RS16450 | 3337481..3337789 | + | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T261049 WP_002886902.1 NZ_CP107390:3332989-3333273 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |