261030

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 172425..173095 Replicon plasmid unnamed1
Accession NZ_CP107384
Organism Klebsiella pneumoniae strain CRKP_29

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OH507_RS27875 Protein ID WP_004213072.1
Coordinates 172652..173095 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OH507_RS27870 Protein ID WP_004213073.1
Coordinates 172425..172655 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH507_RS27845 168648..169547 - 900 WP_004225022.1 nucleotide-binding protein -
OH507_RS27850 169537..169827 - 291 WP_004213078.1 hypothetical protein -
OH507_RS27855 170179..170385 + 207 WP_004213077.1 hypothetical protein -
OH507_RS27860 170375..170668 - 294 WP_004213076.1 hypothetical protein -
OH507_RS27865 170684..171817 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
OH507_RS27870 172425..172655 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH507_RS27875 172652..173095 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OH507_RS27880 173244..173495 + 252 WP_186987481.1 hypothetical protein -
OH507_RS27885 173518..173822 - 305 Protein_196 transposase -
OH507_RS27890 174239..174874 + 636 Protein_197 mucoid phenotype regulator RmpA2 -
OH507_RS27895 175392..175795 - 404 Protein_198 GAF domain-containing protein -
OH507_RS27900 175886..176806 - 921 WP_004213934.1 DUF1471 domain-containing protein -
OH507_RS27905 176855..177346 - 492 WP_011251327.1 DM13 domain-containing protein -
OH507_RS27910 177409..177684 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..194591 194591


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T261030 WP_004213072.1 NZ_CP107384:172652-173095 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT261030 WP_004213073.1 NZ_CP107384:172425-172655 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References