Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 17666..18576 Replicon plasmid unnamed1
Accession NZ_CP107373
Organism Klebsiella pneumoniae strain CRKP_31

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OH494_RS27035 Protein ID WP_004026354.1
Coordinates 18106..18576 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OH494_RS27030 Protein ID WP_004026357.1
Coordinates 17666..18109 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH494_RS27000 12701..13102 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
OH494_RS27005 13175..14077 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
OH494_RS27010 14220..14441 - 222 WP_004213615.1 hypothetical protein -
OH494_RS27015 14503..15810 - 1308 Protein_20 FepA family TonB-dependent siderophore receptor -
OH494_RS27020 15876..16856 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OH494_RS27025 17062..17565 + 504 Protein_22 DUF4113 domain-containing protein -
OH494_RS27030 17666..18109 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OH494_RS27035 18106..18576 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OH494_RS27040 18725..19422 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OH494_RS27045 19424..19873 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OH494_RS27050 19890..20201 + 312 WP_011251282.1 hypothetical protein -
OH494_RS27055 20215..20556 + 342 WP_011251281.1 hypothetical protein -
OH494_RS27060 20616..21572 + 957 WP_011251280.1 DsbA family protein -
OH494_RS27065 21997..22437 - 441 WP_011251275.1 hypothetical protein -
OH494_RS27070 22443..22937 - 495 WP_011251274.1 hypothetical protein -
OH494_RS27075 22946..23260 - 315 WP_011251273.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..193835 193835
- inside IScluster/Tn - rmpA / iroN 4880..24857 19977


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260977 WP_004026354.1 NZ_CP107373:18106-18576 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260977 WP_004026357.1 NZ_CP107373:17666-18109 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References