Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 1704..2284 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107369 | ||
Organism | Klebsiella pneumoniae strain CRKP_32 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OH524_RS27890 | Protein ID | WP_071177730.1 |
Coordinates | 1970..2284 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OH524_RS27885 | Protein ID | WP_000093040.1 |
Coordinates | 1704..1982 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH524_RS27870 | 277..522 | + | 246 | WP_032440458.1 | hypothetical protein | - |
OH524_RS27875 | 796..1167 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OH524_RS27880 | 1164..1529 | + | 366 | WP_072354022.1 | TonB family protein | - |
OH524_RS27885 | 1704..1982 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OH524_RS27890 | 1970..2284 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH524_RS27895 | 2448..2876 | + | 429 | WP_001140599.1 | hypothetical protein | - |
OH524_RS27900 | 2902..3081 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OH524_RS27905 | 3108..3638 | - | 531 | WP_071177729.1 | hypothetical protein | - |
OH524_RS27910 | 3645..4376 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OH524_RS27915 | 4376..6340 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11948 | 11948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T260962 WP_071177730.1 NZ_CP107369:1970-2284 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|