Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 140912..141555 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107368 | ||
Organism | Klebsiella pneumoniae strain CRKP_32 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH524_RS27795 | Protein ID | WP_001044770.1 |
Coordinates | 141139..141555 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH524_RS27790 | Protein ID | WP_001261282.1 |
Coordinates | 140912..141142 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH524_RS27755 (136135) | 136135..136914 | - | 780 | WP_013214009.1 | site-specific integrase | - |
OH524_RS27760 (137098) | 137098..138102 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
OH524_RS27765 (138132) | 138132..138335 | - | 204 | WP_011977813.1 | hypothetical protein | - |
OH524_RS27770 (138381) | 138381..138902 | - | 522 | WP_013214008.1 | hypothetical protein | - |
OH524_RS27775 (138960) | 138960..139352 | - | 393 | WP_011977811.1 | hypothetical protein | - |
OH524_RS27780 (139389) | 139389..140333 | - | 945 | WP_011977810.1 | hypothetical protein | - |
OH524_RS27785 (140494) | 140494..140955 | - | 462 | WP_014343465.1 | hypothetical protein | - |
OH524_RS27790 (140912) | 140912..141142 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH524_RS27795 (141139) | 141139..141555 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH524_RS27800 (141629) | 141629..143191 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH524_RS27805 (143176) | 143176..144198 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
OH524_RS27810 (144454) | 144454..145151 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
OH524_RS27815 (145180) | 145180..145452 | + | 273 | Protein_193 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / catA2 | - | 1..152729 | 152729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260961 WP_001044770.1 NZ_CP107368:141139-141555 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |