Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 140912..141555 Replicon plasmid unnamed1
Accession NZ_CP107368
Organism Klebsiella pneumoniae strain CRKP_32

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH524_RS27795 Protein ID WP_001044770.1
Coordinates 141139..141555 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH524_RS27790 Protein ID WP_001261282.1
Coordinates 140912..141142 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH524_RS27755 (136135) 136135..136914 - 780 WP_013214009.1 site-specific integrase -
OH524_RS27760 (137098) 137098..138102 - 1005 WP_011977814.1 hypothetical protein -
OH524_RS27765 (138132) 138132..138335 - 204 WP_011977813.1 hypothetical protein -
OH524_RS27770 (138381) 138381..138902 - 522 WP_013214008.1 hypothetical protein -
OH524_RS27775 (138960) 138960..139352 - 393 WP_011977811.1 hypothetical protein -
OH524_RS27780 (139389) 139389..140333 - 945 WP_011977810.1 hypothetical protein -
OH524_RS27785 (140494) 140494..140955 - 462 WP_014343465.1 hypothetical protein -
OH524_RS27790 (140912) 140912..141142 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH524_RS27795 (141139) 141139..141555 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH524_RS27800 (141629) 141629..143191 + 1563 WP_004206609.1 AAA family ATPase -
OH524_RS27805 (143176) 143176..144198 + 1023 WP_000361404.1 helicase UvrD -
OH524_RS27810 (144454) 144454..145151 + 698 WP_223174630.1 IS1 family transposase -
OH524_RS27815 (145180) 145180..145452 + 273 Protein_193 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / catA2 - 1..152729 152729


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260961 WP_001044770.1 NZ_CP107368:141139-141555 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260961 WP_001261282.1 NZ_CP107368:140912-141142 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References