Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 746470..747263 | Replicon | chromosome |
Accession | NZ_CP107367 | ||
Organism | Klebsiella pneumoniae strain CRKP_32 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | OH524_RS03740 | Protein ID | WP_004150910.1 |
Coordinates | 746778..747263 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | OH524_RS03735 | Protein ID | WP_272029500.1 |
Coordinates | 746470..746781 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH524_RS03720 | 742242..743390 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
OH524_RS03725 | 743401..744777 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
OH524_RS03730 | 745505..746473 | + | 969 | WP_013362812.1 | IS5-like element IS903B family transposase | - |
OH524_RS03735 | 746470..746781 | + | 312 | WP_272029500.1 | DUF1778 domain-containing protein | Antitoxin |
OH524_RS03740 | 746778..747263 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
OH524_RS03745 | 747967..748560 | + | 594 | WP_004188553.1 | hypothetical protein | - |
OH524_RS03750 | 748657..748873 | + | 217 | Protein_737 | transposase | - |
OH524_RS03755 | 749479..750351 | + | 873 | WP_004188557.1 | ParA family protein | - |
OH524_RS03760 | 750351..750734 | + | 384 | WP_004150906.1 | hypothetical protein | - |
OH524_RS03765 | 750727..752094 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 745550..748809 | 3259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T260942 WP_004150910.1 NZ_CP107367:746778-747263 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|