Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 46641..47284 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107364 | ||
| Organism | Klebsiella pneumoniae strain CRKP_33 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH511_RS27120 | Protein ID | WP_001044770.1 |
| Coordinates | 46868..47284 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH511_RS27115 | Protein ID | WP_001261282.1 |
| Coordinates | 46641..46871 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH511_RS27080 (41864) | 41864..42643 | - | 780 | WP_013214009.1 | site-specific integrase | - |
| OH511_RS27085 (42827) | 42827..43831 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH511_RS27090 (43861) | 43861..44064 | - | 204 | WP_011977813.1 | hypothetical protein | - |
| OH511_RS27095 (44110) | 44110..44631 | - | 522 | WP_013214008.1 | hypothetical protein | - |
| OH511_RS27100 (44689) | 44689..45081 | - | 393 | WP_011977811.1 | hypothetical protein | - |
| OH511_RS27105 (45118) | 45118..46062 | - | 945 | WP_011977810.1 | hypothetical protein | - |
| OH511_RS27110 (46223) | 46223..46684 | - | 462 | WP_014343465.1 | hypothetical protein | - |
| OH511_RS27115 (46641) | 46641..46871 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH511_RS27120 (46868) | 46868..47284 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH511_RS27125 (47358) | 47358..48920 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH511_RS27130 (48905) | 48905..49927 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH511_RS27135 (50183) | 50183..50880 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| OH511_RS27140 (50909) | 50909..51181 | + | 273 | Protein_72 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..121138 | 121138 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260932 WP_001044770.1 NZ_CP107364:46868-47284 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |