Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 46641..47284 Replicon plasmid unnamed1
Accession NZ_CP107364
Organism Klebsiella pneumoniae strain CRKP_33

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH511_RS27120 Protein ID WP_001044770.1
Coordinates 46868..47284 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH511_RS27115 Protein ID WP_001261282.1
Coordinates 46641..46871 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH511_RS27080 (41864) 41864..42643 - 780 WP_013214009.1 site-specific integrase -
OH511_RS27085 (42827) 42827..43831 - 1005 WP_011977814.1 hypothetical protein -
OH511_RS27090 (43861) 43861..44064 - 204 WP_011977813.1 hypothetical protein -
OH511_RS27095 (44110) 44110..44631 - 522 WP_013214008.1 hypothetical protein -
OH511_RS27100 (44689) 44689..45081 - 393 WP_011977811.1 hypothetical protein -
OH511_RS27105 (45118) 45118..46062 - 945 WP_011977810.1 hypothetical protein -
OH511_RS27110 (46223) 46223..46684 - 462 WP_014343465.1 hypothetical protein -
OH511_RS27115 (46641) 46641..46871 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH511_RS27120 (46868) 46868..47284 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH511_RS27125 (47358) 47358..48920 + 1563 WP_004206609.1 AAA family ATPase -
OH511_RS27130 (48905) 48905..49927 + 1023 WP_000361404.1 helicase UvrD -
OH511_RS27135 (50183) 50183..50880 + 698 WP_223174630.1 IS1 family transposase -
OH511_RS27140 (50909) 50909..51181 + 273 Protein_72 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..121138 121138


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260932 WP_001044770.1 NZ_CP107364:46868-47284 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260932 WP_001261282.1 NZ_CP107364:46641-46871 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References