Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3989713..3990332 | Replicon | chromosome |
Accession | NZ_CP107363 | ||
Organism | Klebsiella pneumoniae strain CRKP_33 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OH511_RS19550 | Protein ID | WP_002892050.1 |
Coordinates | 3989713..3989931 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OH511_RS19555 | Protein ID | WP_002892066.1 |
Coordinates | 3989958..3990332 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH511_RS19515 | 3985760..3986023 | + | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
OH511_RS19520 | 3986023..3986163 | + | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OH511_RS19525 | 3986160..3986858 | - | 699 | WP_002892021.1 | GNAT family protein | - |
OH511_RS19530 | 3986959..3988410 | + | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OH511_RS19535 | 3988385..3988855 | - | 471 | WP_002892026.1 | YlaC family protein | - |
OH511_RS19540 | 3988876..3989016 | + | 141 | WP_004147370.1 | hypothetical protein | - |
OH511_RS19545 | 3988988..3989554 | - | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OH511_RS19550 | 3989713..3989931 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OH511_RS19555 | 3989958..3990332 | - | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OH511_RS19560 | 3990818..3993964 | - | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OH511_RS19565 | 3993987..3995180 | - | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260930 WP_002892050.1 NZ_CP107363:c3989931-3989713 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT260930 WP_002892066.1 NZ_CP107363:c3990332-3989958 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |