Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 4057..4637 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107361 | ||
Organism | Klebsiella pneumoniae strain CRKP_34 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OH518_RS27970 | Protein ID | WP_071177730.1 |
Coordinates | 4057..4371 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OH518_RS27975 | Protein ID | WP_000093040.1 |
Coordinates | 4359..4637 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH518_RS27945 | 1..1965 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
OH518_RS27950 | 1965..2696 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OH518_RS27955 | 2703..3233 | + | 531 | WP_071177729.1 | hypothetical protein | - |
OH518_RS27960 | 3260..3439 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OH518_RS27965 | 3465..3893 | - | 429 | WP_001140599.1 | hypothetical protein | - |
OH518_RS27970 | 4057..4371 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH518_RS27975 | 4359..4637 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OH518_RS27980 | 4812..5177 | - | 366 | WP_072354022.1 | TonB family protein | - |
OH518_RS27985 | 5174..5545 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OH518_RS27990 | 5819..6064 | - | 246 | WP_032440458.1 | hypothetical protein | - |
OH518_RS27995 | 6391..8076 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
OH518_RS28000 | 8086..8343 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
OH518_RS28005 | 8428..8577 | + | 150 | WP_032440454.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T260917 WP_071177730.1 NZ_CP107361:c4371-4057 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|