Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 91854..92497 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107360 | ||
Organism | Klebsiella pneumoniae strain CRKP_34 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH518_RS27485 | Protein ID | WP_001044770.1 |
Coordinates | 91854..92270 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH518_RS27490 | Protein ID | WP_001261282.1 |
Coordinates | 92267..92497 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH518_RS27465 (87957) | 87957..88229 | - | 273 | Protein_110 | transposase | - |
OH518_RS27475 (89211) | 89211..90233 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH518_RS27480 (90218) | 90218..91780 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH518_RS27485 (91854) | 91854..92270 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH518_RS27490 (92267) | 92267..92497 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH518_RS27495 (92454) | 92454..92915 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH518_RS27500 (93076) | 93076..94020 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH518_RS27505 (94057) | 94057..94449 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH518_RS27510 (94507) | 94507..95028 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH518_RS27515 (95074) | 95074..95277 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH518_RS27520 (95307) | 95307..96311 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH518_RS27525 (96495) | 96495..97274 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155508 | 155508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260916 WP_001044770.1 NZ_CP107360:c92270-91854 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |