Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 83012..83537 Replicon plasmid unnamed2
Accession NZ_CP107354
Organism Klebsiella pneumoniae strain CRKP_35

Toxin (Protein)


Gene name ccdB Uniprot ID A0A1D8K3Q5
Locus tag OH515_RS27250 Protein ID WP_006788214.1
Coordinates 83232..83537 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag OH515_RS27245 Protein ID WP_006788213.1
Coordinates 83012..83230 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH515_RS27220 78313..79341 - 1029 WP_265701568.1 Abi family protein -
OH515_RS27225 79502..80083 - 582 WP_265701569.1 hypothetical protein -
OH515_RS27230 80376..81308 - 933 WP_265701570.1 S-4TM family putative pore-forming effector -
OH515_RS27235 81312..82307 - 996 WP_265701571.1 nucleotidyltransferase -
OH515_RS27240 82597..82842 + 246 Protein_104 hypothetical protein -
OH515_RS27245 83012..83230 + 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OH515_RS27250 83232..83537 + 306 WP_006788214.1 type II toxin-antitoxin system toxin CcdB Toxin
OH515_RS27255 83795..84040 + 246 WP_064158658.1 hypothetical protein -
OH515_RS27260 84041..84256 + 216 WP_265701572.1 membrane protein insertion efficiency factor YidD -
OH515_RS27265 84422..85390 + 969 Protein_109 IS5 family transposase -
OH515_RS27270 85435..85632 - 198 WP_185963734.1 DNA-binding protein -
OH515_RS27275 85902..87581 - 1680 WP_272049818.1 SEL1-like repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaCTX-M-3 / blaTEM-1B / floR / tet(A) / mph(A) / sul1 / qnrB91 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 - 1..119995 119995


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11687.46 Da        Isoelectric Point: 7.2015

>T260893 WP_006788214.1 NZ_CP107354:83232-83537 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT260893 WP_006788213.1 NZ_CP107354:83012-83230 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D8K3Q5

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References