Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 83012..83537 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107354 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A1D8K3Q5 |
| Locus tag | OH515_RS27250 | Protein ID | WP_006788214.1 |
| Coordinates | 83232..83537 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A1D8K3R4 |
| Locus tag | OH515_RS27245 | Protein ID | WP_006788213.1 |
| Coordinates | 83012..83230 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS27220 | 78313..79341 | - | 1029 | WP_265701568.1 | Abi family protein | - |
| OH515_RS27225 | 79502..80083 | - | 582 | WP_265701569.1 | hypothetical protein | - |
| OH515_RS27230 | 80376..81308 | - | 933 | WP_265701570.1 | S-4TM family putative pore-forming effector | - |
| OH515_RS27235 | 81312..82307 | - | 996 | WP_265701571.1 | nucleotidyltransferase | - |
| OH515_RS27240 | 82597..82842 | + | 246 | Protein_104 | hypothetical protein | - |
| OH515_RS27245 | 83012..83230 | + | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OH515_RS27250 | 83232..83537 | + | 306 | WP_006788214.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OH515_RS27255 | 83795..84040 | + | 246 | WP_064158658.1 | hypothetical protein | - |
| OH515_RS27260 | 84041..84256 | + | 216 | WP_265701572.1 | membrane protein insertion efficiency factor YidD | - |
| OH515_RS27265 | 84422..85390 | + | 969 | Protein_109 | IS5 family transposase | - |
| OH515_RS27270 | 85435..85632 | - | 198 | WP_185963734.1 | DNA-binding protein | - |
| OH515_RS27275 | 85902..87581 | - | 1680 | WP_272049818.1 | SEL1-like repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qnrS1 / blaCTX-M-3 / blaTEM-1B / floR / tet(A) / mph(A) / sul1 / qnrB91 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..119995 | 119995 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11687.46 Da Isoelectric Point: 7.2015
>T260893 WP_006788214.1 NZ_CP107354:83232-83537 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8K3Q5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8K3R4 |