Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 274518..275155 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107353 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OH515_RS26570 | Protein ID | WP_087638532.1 |
| Coordinates | 274745..275155 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | OH515_RS26565 | Protein ID | WP_044265857.1 |
| Coordinates | 274518..274748 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS26550 | 270230..270838 | + | 609 | WP_044265848.1 | hypothetical protein | - |
| OH515_RS26555 | 270831..271712 | + | 882 | WP_044265851.1 | hypothetical protein | - |
| OH515_RS26560 | 271992..274130 | - | 2139 | WP_044265854.1 | AAA family ATPase | - |
| OH515_RS26565 | 274518..274748 | + | 231 | WP_044265857.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH515_RS26570 | 274745..275155 | + | 411 | WP_087638532.1 | PIN domain-containing protein | Toxin |
| OH515_RS26575 | 275314..276294 | + | 981 | WP_044265863.1 | hypothetical protein | - |
| OH515_RS26580 | 276542..277243 | + | 702 | WP_044265986.1 | aspartate/glutamate racemase family protein | - |
| OH515_RS26585 | 277250..277375 | - | 126 | Protein_301 | IS5/IS1182 family transposase | - |
| OH515_RS26590 | 277751..278212 | - | 462 | WP_044265866.1 | Lrp/AsnC family transcriptional regulator | - |
| OH515_RS26595 | 278421..279515 | + | 1095 | WP_272049723.1 | aromatic amino acid transport family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..299789 | 299789 | |
| - | flank | IS/Tn | - | - | 279760..280263 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14426.37 Da Isoelectric Point: 4.4964
>T260892 WP_087638532.1 NZ_CP107353:274745-275155 [Klebsiella pneumoniae]
VNRTYMLDTRFCAFILREQPEAVLGWLEQAVLRGHRIVISAITWAELSQAAREDSPATQALADAFCASLDVVLPWDRAAV
DATTEIKAALAATGTPLGPNDTAIAGHAIAAGAVLVTRNGGEFERVPGLTLQDWAG
VNRTYMLDTRFCAFILREQPEAVLGWLEQAVLRGHRIVISAITWAELSQAAREDSPATQALADAFCASLDVVLPWDRAAV
DATTEIKAALAATGTPLGPNDTAIAGHAIAAGAVLVTRNGGEFERVPGLTLQDWAG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|