Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 255323..255966 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107353 | ||
Organism | Klebsiella pneumoniae strain CRKP_35 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OH515_RS26480 | Protein ID | WP_032720618.1 |
Coordinates | 255550..255966 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | OH515_RS26475 | Protein ID | WP_032720617.1 |
Coordinates | 255323..255553 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH515_RS26455 | 250894..251826 | + | 933 | WP_032720614.1 | S-4TM family putative pore-forming effector | - |
OH515_RS26460 | 252136..252720 | + | 585 | WP_032720615.1 | hypothetical protein | - |
OH515_RS26465 | 252785..254026 | + | 1242 | WP_032720616.1 | RES family NAD+ phosphorylase | - |
OH515_RS26470 | 254116..254982 | - | 867 | WP_050548602.1 | hypothetical protein | - |
OH515_RS26475 | 255323..255553 | + | 231 | WP_032720617.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH515_RS26480 | 255550..255966 | + | 417 | WP_032720618.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH515_RS26485 | 256040..257602 | + | 1563 | WP_032720619.1 | AAA family ATPase | - |
OH515_RS26490 | 257587..258609 | + | 1023 | WP_159196574.1 | DNA helicase UvrD | - |
OH515_RS26495 | 258997..259194 | - | 198 | Protein_283 | transposase | - |
OH515_RS26500 | 259558..260070 | + | 513 | WP_032720621.1 | GrpB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..299789 | 299789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15179.60 Da Isoelectric Point: 7.2453
>T260891 WP_032720618.1 NZ_CP107353:255550-255966 [Klebsiella pneumoniae]
VNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
VNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|