Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 217612..218282 Replicon plasmid unnamed1
Accession NZ_CP107353
Organism Klebsiella pneumoniae strain CRKP_35

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OH515_RS26265 Protein ID WP_004213072.1
Coordinates 217839..218282 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OH515_RS26260 Protein ID WP_004213073.1
Coordinates 217612..217842 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH515_RS26235 213835..214734 - 900 WP_004225022.1 nucleotide-binding protein -
OH515_RS26240 214724..215014 - 291 WP_004213078.1 hypothetical protein -
OH515_RS26245 215366..215572 + 207 WP_004213077.1 hypothetical protein -
OH515_RS26250 215562..215855 - 294 WP_004213076.1 hypothetical protein -
OH515_RS26255 215871..217004 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
OH515_RS26260 217612..217842 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH515_RS26265 217839..218282 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OH515_RS26270 218431..218682 + 252 WP_186987481.1 hypothetical protein -
OH515_RS26275 218705..219009 - 305 Protein_239 transposase -
OH515_RS26280 219426..220061 + 636 Protein_240 mucoid phenotype regulator RmpA2 -
OH515_RS26285 220579..220982 - 404 Protein_241 GAF domain-containing protein -
OH515_RS26290 221073..221993 - 921 WP_004213934.1 DUF1471 domain-containing protein -
OH515_RS26295 222042..222533 - 492 WP_011251327.1 DM13 domain-containing protein -
OH515_RS26300 222596..222871 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..299789 299789


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260890 WP_004213072.1 NZ_CP107353:217839-218282 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260890 WP_004213073.1 NZ_CP107353:217612-217842 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References