Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 174054..174805 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107353 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | OH515_RS26040 | Protein ID | WP_048333033.1 |
| Coordinates | 174323..174805 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | OH515_RS26035 | Protein ID | WP_004902250.1 |
| Coordinates | 174054..174332 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS26015 | 171325..171807 | + | 483 | WP_172694439.1 | hypothetical protein | - |
| OH515_RS26020 | 172051..172365 | - | 315 | WP_023288299.1 | hypothetical protein | - |
| OH515_RS26025 | 173271..173612 | + | 342 | WP_032437747.1 | hypothetical protein | - |
| OH515_RS26030 | 173720..173932 | + | 213 | WP_016946198.1 | hypothetical protein | - |
| OH515_RS26035 | 174054..174332 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| OH515_RS26040 | 174323..174805 | + | 483 | WP_048333033.1 | GNAT family N-acetyltransferase | Toxin |
| OH515_RS26045 | 175840..176379 | + | 540 | WP_004902239.1 | hypothetical protein | - |
| OH515_RS26050 | 176484..176876 | + | 393 | WP_032442757.1 | hypothetical protein | - |
| OH515_RS26055 | 176977..177732 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| OH515_RS26060 | 177759..178406 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..299789 | 299789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17708.53 Da Isoelectric Point: 8.9130
>T260889 WP_048333033.1 NZ_CP107353:174323-174805 [Klebsiella pneumoniae]
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|