Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 108923..109833 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107353 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A663AYG0 |
| Locus tag | OH515_RS25660 | Protein ID | WP_004026354.1 |
| Coordinates | 108923..109393 (-) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A6P1V3Q9 |
| Locus tag | OH515_RS25665 | Protein ID | WP_004026357.1 |
| Coordinates | 109390..109833 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS25635 | 104001..104399 | - | 399 | WP_004212796.1 | H-NS family nucleoid-associated regulatory protein | - |
| OH515_RS25640 | 104736..105230 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| OH515_RS25645 | 105408..105674 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| OH515_RS25650 | 105707..106357 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| OH515_RS25660 | 108923..109393 | - | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
| OH515_RS25665 | 109390..109833 | - | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
| OH515_RS25670 | 109934..110437 | - | 504 | Protein_118 | DUF4113 domain-containing protein | - |
| OH515_RS25675 | 110535..110756 | - | 222 | WP_004213643.1 | DUF2188 domain-containing protein | - |
| OH515_RS25680 | 110931..111056 | - | 126 | Protein_120 | Fe3+-citrate ABC transporter substrate-binding protein | - |
| OH515_RS25685 | 111131..113257 | - | 2127 | WP_004213640.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
| OH515_RS25690 | 113344..114297 | - | 954 | Protein_122 | fec operon regulator FecR | - |
| OH515_RS25695 | 114294..114815 | - | 522 | WP_004213635.1 | ferric citrate uptake sigma factor FecI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..299789 | 299789 | |
| - | flank | IS/Tn | - | - | 107743..108246 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T260888 WP_004026354.1 NZ_CP107353:c109393-108923 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT260888 WP_004026357.1 NZ_CP107353:c109833-109390 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AYG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V3Q9 |