Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 108923..109833 Replicon plasmid unnamed1
Accession NZ_CP107353
Organism Klebsiella pneumoniae strain CRKP_35

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OH515_RS25660 Protein ID WP_004026354.1
Coordinates 108923..109393 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OH515_RS25665 Protein ID WP_004026357.1
Coordinates 109390..109833 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH515_RS25635 104001..104399 - 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -
OH515_RS25640 104736..105230 - 495 WP_004212794.1 thermonuclease family protein -
OH515_RS25645 105408..105674 + 267 WP_223175074.1 DUF1173 family protein -
OH515_RS25650 105707..106357 + 651 WP_068893702.1 DUF1173 family protein -
OH515_RS25660 108923..109393 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OH515_RS25665 109390..109833 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OH515_RS25670 109934..110437 - 504 Protein_118 DUF4113 domain-containing protein -
OH515_RS25675 110535..110756 - 222 WP_004213643.1 DUF2188 domain-containing protein -
OH515_RS25680 110931..111056 - 126 Protein_120 Fe3+-citrate ABC transporter substrate-binding protein -
OH515_RS25685 111131..113257 - 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
OH515_RS25690 113344..114297 - 954 Protein_122 fec operon regulator FecR -
OH515_RS25695 114294..114815 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..299789 299789
- flank IS/Tn - - 107743..108246 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260888 WP_004026354.1 NZ_CP107353:c109393-108923 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260888 WP_004026357.1 NZ_CP107353:c109833-109390 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References