Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 36296..36818 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107353 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | - |
| Locus tag | OH515_RS25260 | Protein ID | WP_044265921.1 |
| Coordinates | 36296..36580 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
| Locus tag | OH515_RS25265 | Protein ID | WP_004187025.1 |
| Coordinates | 36570..36818 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS25245 | 33228..33746 | + | 519 | WP_227627021.1 | DinB family protein | - |
| OH515_RS25250 | 33868..34833 | - | 966 | WP_044265916.1 | hypothetical protein | - |
| OH515_RS25255 | 35006..36280 | + | 1275 | WP_044265918.1 | ISNCY family transposase | - |
| OH515_RS25260 | 36296..36580 | - | 285 | WP_044265921.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH515_RS25265 | 36570..36818 | - | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
| OH515_RS25270 | 37227..37694 | - | 468 | WP_044265924.1 | GNAT family N-acetyltransferase | - |
| OH515_RS25275 | 38080..38637 | + | 558 | WP_044265927.1 | OsmC family protein | - |
| OH515_RS25280 | 38824..39393 | + | 570 | WP_044265930.1 | TetR/AcrR family transcriptional regulator | - |
| OH515_RS25285 | 39411..39749 | + | 339 | WP_044265932.1 | carboxymuconolactone decarboxylase family protein | - |
| OH515_RS25290 | 40158..40526 | + | 369 | Protein_42 | Arm DNA-binding domain-containing protein | - |
| OH515_RS25295 | 40529..40741 | + | 213 | Protein_43 | DUF3363 domain-containing protein | - |
| OH515_RS25300 | 40770..41591 | - | 822 | WP_044265935.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..299789 | 299789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11012.73 Da Isoelectric Point: 10.5388
>T260887 WP_044265921.1 NZ_CP107353:c36580-36296 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTLQVHFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVHFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|