Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 4306377..4306967 | Replicon | chromosome |
Accession | NZ_CP107352 | ||
Organism | Klebsiella pneumoniae strain CRKP_35 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OH515_RS20685 | Protein ID | WP_032421545.1 |
Coordinates | 4306635..4306967 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OH515_RS20680 | Protein ID | WP_032421546.1 |
Coordinates | 4306377..4306634 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH515_RS20665 (4303706) | 4303706..4304968 | - | 1263 | WP_198921206.1 | hypothetical protein | - |
OH515_RS20670 (4305353) | 4305353..4305826 | + | 474 | WP_050597676.1 | hypothetical protein | - |
OH515_RS20675 (4305823) | 4305823..4306029 | + | 207 | WP_080217966.1 | helix-turn-helix transcriptional regulator | - |
OH515_RS20680 (4306377) | 4306377..4306634 | + | 258 | WP_032421546.1 | antitoxin | Antitoxin |
OH515_RS20685 (4306635) | 4306635..4306967 | + | 333 | WP_032421545.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OH515_RS20695 (4307289) | 4307289..4308725 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
OH515_RS20705 (4309091) | 4309091..4310545 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
OH515_RS20710 (4310675) | 4310675..4310920 | - | 246 | WP_064162645.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4296616..4306967 | 10351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11917.79 Da Isoelectric Point: 10.0968
>T260882 WP_032421545.1 NZ_CP107352:4306635-4306967 [Klebsiella pneumoniae]
MDRGEIWLVSLDPTSGHEQSGKRPVLIVSKASFNKLTQLPVIVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPTSGHEQSGKRPVLIVSKASFNKLTQLPVIVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|