Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3383223..3383880 | Replicon | chromosome |
Accession | NZ_CP107352 | ||
Organism | Klebsiella pneumoniae strain CRKP_35 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OH515_RS16365 | Protein ID | WP_002916310.1 |
Coordinates | 3383470..3383880 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OH515_RS16360 | Protein ID | WP_002916312.1 |
Coordinates | 3383223..3383489 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH515_RS16335 (3378379) | 3378379..3379812 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
OH515_RS16340 (3379931) | 3379931..3380659 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OH515_RS16345 (3380709) | 3380709..3381020 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
OH515_RS16350 (3381184) | 3381184..3381843 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
OH515_RS16355 (3381994) | 3381994..3382977 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
OH515_RS16360 (3383223) | 3383223..3383489 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OH515_RS16365 (3383470) | 3383470..3383880 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OH515_RS16370 (3383887) | 3383887..3384408 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
OH515_RS16375 (3384509) | 3384509..3385405 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OH515_RS16380 (3385428) | 3385428..3386141 | + | 714 | WP_135696293.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OH515_RS16385 (3386147) | 3386147..3387880 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T260881 WP_002916310.1 NZ_CP107352:3383470-3383880 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |