Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1358523..1359142 Replicon chromosome
Accession NZ_CP107352
Organism Klebsiella pneumoniae strain CRKP_35

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH515_RS06595 Protein ID WP_002892050.1
Coordinates 1358924..1359142 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH515_RS06590 Protein ID WP_002892066.1
Coordinates 1358523..1358897 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH515_RS06580 (1353675) 1353675..1354868 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH515_RS06585 (1354891) 1354891..1358037 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OH515_RS06590 (1358523) 1358523..1358897 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH515_RS06595 (1358924) 1358924..1359142 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH515_RS06600 (1359301) 1359301..1359867 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH515_RS06605 (1359839) 1359839..1359979 - 141 WP_004147370.1 hypothetical protein -
OH515_RS06610 (1360000) 1360000..1360470 + 471 WP_002892026.1 YlaC family protein -
OH515_RS06615 (1360445) 1360445..1361896 - 1452 WP_135696182.1 PLP-dependent aminotransferase family protein -
OH515_RS06620 (1361997) 1361997..1362695 + 699 WP_002892021.1 GNAT family protein -
OH515_RS06625 (1362692) 1362692..1362832 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH515_RS06630 (1362832) 1362832..1363095 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260875 WP_002892050.1 NZ_CP107352:1358924-1359142 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260875 WP_002892066.1 NZ_CP107352:1358523-1358897 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References