Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 171668..172338 Replicon plasmid unnamed1
Accession NZ_CP107346
Organism Klebsiella pneumoniae strain CRKP_36

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OH497_RS27880 Protein ID WP_004213072.1
Coordinates 171895..172338 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OH497_RS27875 Protein ID WP_004213073.1
Coordinates 171668..171898 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH497_RS27850 167891..168790 - 900 WP_004225022.1 nucleotide-binding protein -
OH497_RS27855 168780..169070 - 291 WP_004213078.1 hypothetical protein -
OH497_RS27860 169422..169628 + 207 WP_004213077.1 hypothetical protein -
OH497_RS27865 169618..169911 - 294 WP_004213076.1 hypothetical protein -
OH497_RS27870 169927..171060 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
OH497_RS27875 171668..171898 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH497_RS27880 171895..172338 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OH497_RS27885 172487..172738 + 252 WP_186987481.1 hypothetical protein -
OH497_RS27890 172761..173065 - 305 Protein_197 transposase -
OH497_RS27895 173482..174117 + 636 Protein_198 mucoid phenotype regulator RmpA2 -
OH497_RS27900 174635..175038 - 404 Protein_199 GAF domain-containing protein -
OH497_RS27905 175129..176049 - 921 WP_004213934.1 DUF1471 domain-containing protein -
OH497_RS27910 176098..176589 - 492 WP_011251327.1 DM13 domain-containing protein -
OH497_RS27915 176652..176927 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..193834 193834


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260863 WP_004213072.1 NZ_CP107346:171895-172338 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260863 WP_004213073.1 NZ_CP107346:171668-171898 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References